Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1852716..1852900 | Replicon | chromosome |
Accession | NZ_CP098253 | ||
Organism | Staphylococcus aureus strain M0 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NB629_RS08725 | Protein ID | WP_000482647.1 |
Coordinates | 1852716..1852823 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1852840..1852900 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB629_RS08700 (NB629_08700) | 1848078..1848551 | + | 474 | WP_000456499.1 | GyrI-like domain-containing protein | - |
NB629_RS08705 (NB629_08705) | 1848674..1849885 | - | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
NB629_RS08710 (NB629_08710) | 1850067..1850726 | - | 660 | WP_000831298.1 | membrane protein | - |
NB629_RS08715 (NB629_08715) | 1850786..1851928 | - | 1143 | WP_001176855.1 | glycerate kinase | - |
NB629_RS08720 (NB629_08720) | 1852196..1852582 | + | 387 | WP_000779351.1 | flippase GtxA | - |
NB629_RS08725 (NB629_08725) | 1852716..1852823 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1852840..1852900 | - | 61 | - | - | Antitoxin |
NB629_RS08730 (NB629_08730) | 1853471..1855234 | + | 1764 | WP_001064828.1 | ATP-binding cassette domain-containing protein | - |
NB629_RS08735 (NB629_08735) | 1855259..1856992 | + | 1734 | WP_000486507.1 | ABC transporter ATP-binding protein | - |
NB629_RS08740 (NB629_08740) | 1857223..1857390 | + | 168 | Protein_1721 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T247363 WP_000482647.1 NZ_CP098253:1852716-1852823 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT247363 NZ_CP098253:c1852900-1852840 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|