Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 161124..161721 | Replicon | chromosome |
Accession | NZ_CP098251 | ||
Organism | Oxalobacter aliiformigenes strain OxK |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | NB646_RS00870 | Protein ID | WP_269316016.1 |
Coordinates | 161443..161721 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NB646_RS00865 | Protein ID | WP_269316015.1 |
Coordinates | 161124..161429 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB646_RS00835 (NB646_00835) | 156528..156737 | + | 210 | WP_269277221.1 | AlpA family transcriptional regulator | - |
NB646_RS00840 (NB646_00840) | 156749..157675 | + | 927 | WP_269316010.1 | toprim domain-containing protein | - |
NB646_RS00845 (NB646_00845) | 157672..159483 | + | 1812 | WP_269316011.1 | DUF927 domain-containing protein | - |
NB646_RS00850 (NB646_00850) | 159963..160235 | + | 273 | WP_269316012.1 | hypothetical protein | - |
NB646_RS00855 (NB646_00855) | 160248..160853 | + | 606 | WP_269316013.1 | hypothetical protein | - |
NB646_RS00860 | 160873..160998 | + | 126 | WP_269316014.1 | hypothetical protein | - |
NB646_RS00865 (NB646_00860) | 161124..161429 | - | 306 | WP_269316015.1 | HigA family addiction module antitoxin | Antitoxin |
NB646_RS00870 (NB646_00865) | 161443..161721 | - | 279 | WP_269316016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NB646_RS00875 (NB646_00870) | 162114..162350 | + | 237 | WP_269316017.1 | hypothetical protein | - |
NB646_RS00880 (NB646_00875) | 162343..162612 | + | 270 | WP_269316018.1 | DUF3077 domain-containing protein | - |
NB646_RS00885 (NB646_00880) | 162722..162982 | - | 261 | WP_269316019.1 | hypothetical protein | - |
NB646_RS00890 (NB646_00885) | 164824..165078 | + | 255 | WP_269316020.1 | hypothetical protein | - |
NB646_RS00895 (NB646_00890) | 165125..166084 | + | 960 | WP_269316021.1 | tetratricopeptide repeat protein | - |
NB646_RS00900 (NB646_00895) | 166202..166540 | + | 339 | WP_269264601.1 | CidA/LrgA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10606.24 Da Isoelectric Point: 9.8920
>T247359 WP_269316016.1 NZ_CP098251:c161721-161443 [Oxalobacter aliiformigenes]
MIQSFSCADTQALFAGRSVPRFVNIRTVAERKLQMLHRAVCLDDLRIPPNNRLEALKGDRKGQYSIRINGQWRLCFRFEG
GHAFDVAIVDYH
MIQSFSCADTQALFAGRSVPRFVNIRTVAERKLQMLHRAVCLDDLRIPPNNRLEALKGDRKGQYSIRINGQWRLCFRFEG
GHAFDVAIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|