Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2149354..2149949 | Replicon | chromosome |
| Accession | NZ_CP098247 | ||
| Organism | Oxalobacter aliiformigenes strain BA2 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | NB636_RS10415 | Protein ID | WP_269280773.1 |
| Coordinates | 2149671..2149949 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NB636_RS10410 | Protein ID | WP_269280775.1 |
| Coordinates | 2149354..2149659 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB636_RS10390 (NB636_10355) | 2144797..2145135 | - | 339 | WP_269264601.1 | CidA/LrgA family protein | - |
| NB636_RS10395 (NB636_10360) | 2145254..2146213 | - | 960 | WP_269280779.1 | tetratricopeptide repeat protein | - |
| NB636_RS10400 (NB636_10365) | 2146261..2146515 | - | 255 | WP_269264599.1 | hypothetical protein | - |
| NB636_RS10405 (NB636_10370) | 2148590..2149219 | + | 630 | WP_269280777.1 | hypothetical protein | - |
| NB636_RS10410 (NB636_10375) | 2149354..2149659 | - | 306 | WP_269280775.1 | HigA family addiction module antitoxin | Antitoxin |
| NB636_RS10415 (NB636_10380) | 2149671..2149949 | - | 279 | WP_269280773.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NB636_RS10420 (NB636_10385) | 2150764..2151054 | + | 291 | WP_269280770.1 | BRO family protein | - |
| NB636_RS10425 (NB636_10390) | 2151051..2151347 | + | 297 | WP_269280767.1 | hypothetical protein | - |
| NB636_RS10430 (NB636_10395) | 2151611..2151895 | - | 285 | WP_269280764.1 | hypothetical protein | - |
| NB636_RS10435 (NB636_10400) | 2151892..2153073 | - | 1182 | WP_269295611.1 | DUF927 domain-containing protein | - |
| NB636_RS10440 (NB636_10405) | 2153022..2154461 | - | 1440 | Protein_2037 | DUF927 domain-containing protein | - |
| NB636_RS10445 (NB636_10410) | 2154584..2154829 | - | 246 | WP_269280759.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10707.39 Da Isoelectric Point: 10.2305
>T247358 WP_269280773.1 NZ_CP098247:c2149949-2149671 [Oxalobacter aliiformigenes]
MIQSFSCTDTQALFAGRSVPRFVNIRTVAERKLQMLHRAVCLDDLRIPPNNRLEALKGDRKKQYSIRINGQWRLCFRFEG
GHAFDVAIVDYH
MIQSFSCTDTQALFAGRSVPRFVNIRTVAERKLQMLHRAVCLDDLRIPPNNRLEALKGDRKKQYSIRINGQWRLCFRFEG
GHAFDVAIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|