Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 421467..422076 | Replicon | chromosome |
| Accession | NZ_CP098247 | ||
| Organism | Oxalobacter aliiformigenes strain BA2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NB636_RS02010 | Protein ID | WP_269280948.1 |
| Coordinates | 421732..422076 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NB636_RS02005 | Protein ID | WP_269280950.1 |
| Coordinates | 421467..421751 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB636_RS01985 (NB636_01980) | 416576..417064 | + | 489 | WP_269280961.1 | terminase small subunit | - |
| NB636_RS01990 (NB636_01985) | 417040..418428 | + | 1389 | WP_269280958.1 | terminase family protein | - |
| NB636_RS01995 (NB636_01990) | 418432..420345 | + | 1914 | WP_269280956.1 | hypothetical protein | - |
| NB636_RS02000 (NB636_01995) | 420354..421373 | + | 1020 | WP_269280953.1 | hypothetical protein | - |
| NB636_RS02005 (NB636_02000) | 421467..421751 | - | 285 | WP_269280950.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NB636_RS02010 (NB636_02005) | 421732..422076 | - | 345 | WP_269280948.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NB636_RS02015 (NB636_02010) | 422118..422375 | + | 258 | WP_269280947.1 | antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 406912..455607 | 48695 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13404.50 Da Isoelectric Point: 10.4974
>T247353 WP_269280948.1 NZ_CP098247:c422076-421732 [Oxalobacter aliiformigenes]
MKKQYSIDYYNDDIRQDVDRWPVSLRARYARLTERMKIYGGNLGEPHTKAFGNGLFELRVKAEVGIGRAFFCTKVGRKII
ILHSFIKKTQKTPKHDLDIALSRMKEKRDEQDSR
MKKQYSIDYYNDDIRQDVDRWPVSLRARYARLTERMKIYGGNLGEPHTKAFGNGLFELRVKAEVGIGRAFFCTKVGRKII
ILHSFIKKTQKTPKHDLDIALSRMKEKRDEQDSR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|