Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1725306..1725895 | Replicon | chromosome |
Accession | NZ_CP098246 | ||
Organism | Oxalobacter formigenes strain HOxSLD-2 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | NB644_RS08120 | Protein ID | WP_005880108.1 |
Coordinates | 1725306..1725584 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NB644_RS08125 | Protein ID | WP_005880107.1 |
Coordinates | 1725596..1725895 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB644_RS08100 (NB644_08060) | 1720434..1720649 | - | 216 | WP_005880112.1 | hypothetical protein | - |
NB644_RS08105 (NB644_08065) | 1720808..1721749 | - | 942 | WP_005880111.1 | tetratricopeptide repeat protein | - |
NB644_RS08110 (NB644_08070) | 1721691..1723400 | - | 1710 | WP_086131830.1 | hypothetical protein | - |
NB644_RS08115 (NB644_08075) | 1723640..1724833 | - | 1194 | WP_005880109.1 | MFS transporter | - |
NB644_RS08120 (NB644_08080) | 1725306..1725584 | + | 279 | WP_005880108.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NB644_RS08125 (NB644_08085) | 1725596..1725895 | + | 300 | WP_005880107.1 | HigA family addiction module antitoxin | Antitoxin |
NB644_RS08130 (NB644_08090) | 1726041..1727108 | - | 1068 | WP_005880106.1 | porin | - |
NB644_RS08135 (NB644_08095) | 1727432..1728511 | - | 1080 | WP_036602709.1 | porin | - |
NB644_RS08140 (NB644_08100) | 1728771..1729781 | - | 1011 | WP_269310490.1 | ADP-glyceromanno-heptose 6-epimerase | - |
NB644_RS08145 (NB644_08105) | 1730177..1730566 | + | 390 | WP_005880102.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10670.21 Da Isoelectric Point: 9.7825
>T247349 WP_005880108.1 NZ_CP098246:1725306-1725584 [Oxalobacter formigenes]
MIKSFTCPDTQDLFAGKTVPRFVNIRSVAERKLQMIHRATGINDLRIPPNNRLEALKGDRKGQYSIRINDQWRICFTFDN
GQAFDVSIVDYH
MIKSFTCPDTQDLFAGKTVPRFVNIRSVAERKLQMIHRATGINDLRIPPNNRLEALKGDRKGQYSIRINDQWRICFTFDN
GQAFDVSIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|