Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1908515..1909104 | Replicon | chromosome |
| Accession | NZ_CP098245 | ||
| Organism | Oxalobacter formigenes strain HOxSLD-1 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | NB642_RS08890 | Protein ID | WP_005880108.1 |
| Coordinates | 1908515..1908793 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NB642_RS08895 | Protein ID | WP_005880107.1 |
| Coordinates | 1908805..1909104 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB642_RS08870 (NB642_08840) | 1903643..1903858 | - | 216 | WP_005880112.1 | hypothetical protein | - |
| NB642_RS08875 (NB642_08845) | 1904017..1904958 | - | 942 | WP_005880111.1 | tetratricopeptide repeat protein | - |
| NB642_RS08880 (NB642_08850) | 1904900..1906609 | - | 1710 | WP_086131830.1 | hypothetical protein | - |
| NB642_RS08885 (NB642_08855) | 1906850..1908043 | - | 1194 | WP_005880109.1 | MFS transporter | - |
| NB642_RS08890 (NB642_08860) | 1908515..1908793 | + | 279 | WP_005880108.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NB642_RS08895 (NB642_08865) | 1908805..1909104 | + | 300 | WP_005880107.1 | HigA family addiction module antitoxin | Antitoxin |
| NB642_RS08900 (NB642_08870) | 1909250..1910317 | - | 1068 | WP_005880106.1 | porin | - |
| NB642_RS08905 (NB642_08875) | 1910641..1911720 | - | 1080 | WP_036602709.1 | porin | - |
| NB642_RS08910 (NB642_08880) | 1911980..1912990 | - | 1011 | WP_269310490.1 | ADP-glyceromanno-heptose 6-epimerase | - |
| NB642_RS08915 (NB642_08885) | 1913386..1913775 | + | 390 | WP_005880102.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10670.21 Da Isoelectric Point: 9.7825
>T247347 WP_005880108.1 NZ_CP098245:1908515-1908793 [Oxalobacter formigenes]
MIKSFTCPDTQDLFAGKTVPRFVNIRSVAERKLQMIHRATGINDLRIPPNNRLEALKGDRKGQYSIRINDQWRICFTFDN
GQAFDVSIVDYH
MIKSFTCPDTQDLFAGKTVPRFVNIRSVAERKLQMIHRATGINDLRIPPNNRLEALKGDRKGQYSIRINDQWRICFTFDN
GQAFDVSIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|