Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 638083..638672 | Replicon | chromosome |
Accession | NZ_CP098244 | ||
Organism | Oxalobacter formigenes strain OxWR1 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | NB639_RS02690 | Protein ID | WP_269307659.1 |
Coordinates | 638394..638672 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NB639_RS02685 | Protein ID | WP_005880107.1 |
Coordinates | 638083..638382 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB639_RS02665 (NB639_02655) | 633412..633801 | - | 390 | WP_005880102.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
NB639_RS02670 (NB639_02660) | 634197..635207 | + | 1011 | WP_005880103.1 | ADP-glyceromanno-heptose 6-epimerase | - |
NB639_RS02675 (NB639_02665) | 635467..636546 | + | 1080 | WP_036602709.1 | porin | - |
NB639_RS02680 (NB639_02670) | 636870..637937 | + | 1068 | WP_005880106.1 | porin | - |
NB639_RS02685 (NB639_02675) | 638083..638382 | - | 300 | WP_005880107.1 | HigA family addiction module antitoxin | Antitoxin |
NB639_RS02690 (NB639_02680) | 638394..638672 | - | 279 | WP_269307659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NB639_RS02695 (NB639_02685) | 639145..640338 | + | 1194 | WP_269307660.1 | MFS transporter | - |
NB639_RS02700 (NB639_02690) | 640579..642288 | + | 1710 | WP_086131830.1 | hypothetical protein | - |
NB639_RS02705 (NB639_02695) | 642230..643171 | + | 942 | WP_005880111.1 | tetratricopeptide repeat protein | - |
NB639_RS02710 (NB639_02700) | 643330..643545 | + | 216 | WP_005880112.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10716.30 Da Isoelectric Point: 9.2981
>T247346 WP_269307659.1 NZ_CP098244:c638672-638394 [Oxalobacter formigenes]
MIKSFTCPDTQDLFAGKTVPRFVNIRSVAERKLQMIHRATCINDLRIPPNNRLEALKGDRKGQYSIRINDQWRICFTFDN
GQAFDVSIVDYH
MIKSFTCPDTQDLFAGKTVPRFVNIRSVAERKLQMIHRATCINDLRIPPNNRLEALKGDRKGQYSIRINDQWRICFTFDN
GQAFDVSIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|