Detailed information of TA system TA247340

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 47177..47603
• Replicon: plasmid unnamed1
• Accession: NZ_CP098235
• Organism: Escherichia coli strain ZYB39

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: KFZ69_RS24490
• Protein ID: WP_001372321.1
• Coordinates: 47478..47603 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	47177..47401 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KFZ69_RS24445 (42230)	42230..42484	+	255	WP_050195272.1	hypothetical protein	-
KFZ69_RS24450 (42382)	42382..42654	+	273	WP_072133095.1	hypothetical protein	-
KFZ69_RS24455 (43127)	43127..43654	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
KFZ69_RS24460 (43710)	43710..43943	+	234	WP_000006004.1	DUF905 domain-containing protein	-
KFZ69_RS24465 (44002)	44002..45960	+	1959	WP_105318609.1	ParB/RepB/Spo0J family partition protein	-
KFZ69_RS24470 (46015)	46015..46449	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
KFZ69_RS24475 (46446)	46446..47208	+	763	Protein_56	plasmid SOS inhibition protein A	-
KFZ69_RS24480 (47177)	47177..47365	-	189	WP_001299721.1	hypothetical protein	-
- (47177)	47177..47401	+	225	NuclAT_0	-	Antitoxin
- (47177)	47177..47401	+	225	NuclAT_0	-	Antitoxin
- (47177)	47177..47401	+	225	NuclAT_0	-	Antitoxin
- (47177)	47177..47401	+	225	NuclAT_0	-	Antitoxin
KFZ69_RS24485 (47387)	47387..47536	+	150	Protein_58	plasmid maintenance protein Mok	-
KFZ69_RS24490 (47478)	47478..47603	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
KFZ69_RS24495 (47823)	47823..48053	+	231	WP_001426396.1	hypothetical protein	-
KFZ69_RS24500 (48051)	48051..48224	-	174	Protein_61	hypothetical protein	-
KFZ69_RS24505 (48294)	48294..48500	+	207	WP_000547939.1	hypothetical protein	-
KFZ69_RS24510 (48525)	48525..48812	+	288	WP_000107535.1	hypothetical protein	-
KFZ69_RS24515 (48933)	48933..49754	+	822	WP_001234469.1	DUF932 domain-containing protein	-
KFZ69_RS24520 (50051)	50051..50698	-	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
KFZ69_RS24525 (50975)	50975..51358	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
KFZ69_RS24530 (51549)	51549..52328	+	780	WP_275874821.1	PAS domain-containing protein	-
KFZ69_RS24535 (52329)	52329..52556	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T247340 WP_001372321.1 NZ_CP098235:47478-47603 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT247340 NZ_CP098235:47177-47401 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin