Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4839717..4840319 | Replicon | chromosome |
Accession | NZ_CP098234 | ||
Organism | Escherichia coli strain ZYB39 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | KFZ69_RS23225 | Protein ID | WP_000897305.1 |
Coordinates | 4840008..4840319 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KFZ69_RS23220 | Protein ID | WP_000356397.1 |
Coordinates | 4839717..4840007 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ69_RS23195 (4835643) | 4835643..4836545 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
KFZ69_RS23200 (4836542) | 4836542..4837177 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
KFZ69_RS23205 (4837174) | 4837174..4838103 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
KFZ69_RS23210 (4838433) | 4838433..4838675 | - | 243 | WP_001086388.1 | protein YiiF | - |
KFZ69_RS23215 (4838894) | 4838894..4839112 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
KFZ69_RS23220 (4839717) | 4839717..4840007 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
KFZ69_RS23225 (4840008) | 4840008..4840319 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
KFZ69_RS23230 (4840548) | 4840548..4841456 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
KFZ69_RS23235 (4841520) | 4841520..4842461 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
KFZ69_RS23240 (4842506) | 4842506..4842943 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
KFZ69_RS23245 (4842940) | 4842940..4843812 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
KFZ69_RS23250 (4843806) | 4843806..4844405 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
KFZ69_RS23255 (4844504) | 4844504..4845289 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T247339 WP_000897305.1 NZ_CP098234:c4840319-4840008 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|