Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44487..44741 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP098233 | ||
| Organism | Escherichia coli strain XJ34 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | KFZ60_RS24715 | Protein ID | WP_001312851.1 |
| Coordinates | 44592..44741 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 44487..44548 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ60_RS24665 (39514) | 39514..40197 | + | 684 | WP_000085939.1 | DNA methylase | - |
| KFZ60_RS24670 (40198) | 40198..40419 | + | 222 | WP_001104904.1 | hypothetical protein | - |
| KFZ60_RS24675 (40313) | 40313..40867 | + | 555 | WP_001358893.1 | DUF1380 family protein | - |
| KFZ60_RS24680 (40913) | 40913..41689 | + | 777 | WP_001005032.1 | hypothetical protein | - |
| KFZ60_RS24685 (41870) | 41870..42199 | + | 330 | Protein_35 | antirestriction protein | - |
| KFZ60_RS24690 (42199) | 42199..42477 | + | 279 | Protein_36 | TraX family protein | - |
| KFZ60_RS24695 (42532) | 42532..43092 | + | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| KFZ60_RS24700 (43227) | 43227..43415 | + | 189 | WP_001345829.1 | hypothetical protein | - |
| KFZ60_RS24705 (43613) | 43613..43699 | + | 87 | Protein_39 | endonuclease | - |
| KFZ60_RS24710 (43880) | 43880..44191 | - | 312 | WP_000802277.1 | hypothetical protein | - |
| - (44487) | 44487..44548 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (44487) | 44487..44548 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (44487) | 44487..44548 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (44487) | 44487..44548 | - | 62 | NuclAT_0 | - | Antitoxin |
| KFZ60_RS24715 (44592) | 44592..44741 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| KFZ60_RS24720 (45025) | 45025..45282 | + | 258 | WP_000083834.1 | replication regulatory protein RepA | - |
| KFZ60_RS24725 (45516) | 45516..45590 | + | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| KFZ60_RS24730 (45583) | 45583..46065 | + | 483 | WP_001443034.1 | hypothetical protein | - |
| KFZ60_RS24735 (46058) | 46058..46915 | + | 858 | WP_000774301.1 | incFII family plasmid replication initiator RepA | - |
| KFZ60_RS24740 (47849) | 47849..48733 | + | 885 | WP_001345827.1 | hypothetical protein | - |
| KFZ60_RS24745 (48729) | 48729..48898 | + | 170 | Protein_47 | resolvase | - |
| KFZ60_RS24750 (49153) | 49153..49299 | + | 147 | Protein_48 | 3'-5' exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..72766 | 72766 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T247314 WP_001312851.1 NZ_CP098233:44592-44741 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT247314 NZ_CP098233:c44548-44487 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
