Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3792727..3793421 Replicon chromosome
Accession NZ_CP098231
Organism Escherichia coli strain XJ34

Toxin (Protein)


Gene name yafO Uniprot ID A0A1E5WU64
Locus tag KFZ60_RS18325 Protein ID WP_001263494.1
Coordinates 3792727..3793125 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag KFZ60_RS18330 Protein ID WP_000554757.1
Coordinates 3793128..3793421 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3788502) 3788502..3788582 - 81 NuclAT_12 - -
- (3788502) 3788502..3788582 - 81 NuclAT_12 - -
- (3788502) 3788502..3788582 - 81 NuclAT_12 - -
- (3788502) 3788502..3788582 - 81 NuclAT_12 - -
KFZ60_RS18295 (3787842) 3787842..3789086 - 1245 WP_000189541.1 esterase FrsA -
KFZ60_RS18300 (3789178) 3789178..3789636 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
KFZ60_RS18305 (3789897) 3789897..3791354 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
KFZ60_RS18310 (3791411) 3791411..3791719 - 309 Protein_3586 peptide chain release factor-like protein -
KFZ60_RS18315 (3791739) 3791739..3791947 - 209 Protein_3587 RtcB family protein -
KFZ60_RS18320 (3792265) 3792265..3792717 - 453 WP_088376518.1 GNAT family N-acetyltransferase -
KFZ60_RS18325 (3792727) 3792727..3793125 - 399 WP_001263494.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
KFZ60_RS18330 (3793128) 3793128..3793421 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
KFZ60_RS18335 (3793473) 3793473..3794528 - 1056 WP_001226164.1 DNA polymerase IV -
KFZ60_RS18340 (3794599) 3794599..3795384 - 786 WP_162859066.1 putative lateral flagellar export/assembly protein LafU -
KFZ60_RS18345 (3795356) 3795356..3797068 + 1713 Protein_3593 flagellar biosynthesis protein FlhA -
KFZ60_RS18350 (3797301) 3797301..3797798 - 498 WP_047625020.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3734326..3793421 59095


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15485.91 Da        Isoelectric Point: 8.0949

>T247306 WP_001263494.1 NZ_CP098231:c3793125-3792727 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGVFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT247306 WP_000554757.1 NZ_CP098231:c3793421-3793128 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1E5WU64

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References