Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3792727..3793421 | Replicon | chromosome |
Accession | NZ_CP098231 | ||
Organism | Escherichia coli strain XJ34 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A1E5WU64 |
Locus tag | KFZ60_RS18325 | Protein ID | WP_001263494.1 |
Coordinates | 3792727..3793125 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | KFZ60_RS18330 | Protein ID | WP_000554757.1 |
Coordinates | 3793128..3793421 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3788502) | 3788502..3788582 | - | 81 | NuclAT_12 | - | - |
- (3788502) | 3788502..3788582 | - | 81 | NuclAT_12 | - | - |
- (3788502) | 3788502..3788582 | - | 81 | NuclAT_12 | - | - |
- (3788502) | 3788502..3788582 | - | 81 | NuclAT_12 | - | - |
KFZ60_RS18295 (3787842) | 3787842..3789086 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
KFZ60_RS18300 (3789178) | 3789178..3789636 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
KFZ60_RS18305 (3789897) | 3789897..3791354 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
KFZ60_RS18310 (3791411) | 3791411..3791719 | - | 309 | Protein_3586 | peptide chain release factor-like protein | - |
KFZ60_RS18315 (3791739) | 3791739..3791947 | - | 209 | Protein_3587 | RtcB family protein | - |
KFZ60_RS18320 (3792265) | 3792265..3792717 | - | 453 | WP_088376518.1 | GNAT family N-acetyltransferase | - |
KFZ60_RS18325 (3792727) | 3792727..3793125 | - | 399 | WP_001263494.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
KFZ60_RS18330 (3793128) | 3793128..3793421 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
KFZ60_RS18335 (3793473) | 3793473..3794528 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
KFZ60_RS18340 (3794599) | 3794599..3795384 | - | 786 | WP_162859066.1 | putative lateral flagellar export/assembly protein LafU | - |
KFZ60_RS18345 (3795356) | 3795356..3797068 | + | 1713 | Protein_3593 | flagellar biosynthesis protein FlhA | - |
KFZ60_RS18350 (3797301) | 3797301..3797798 | - | 498 | WP_047625020.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3734326..3793421 | 59095 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15485.91 Da Isoelectric Point: 8.0949
>T247306 WP_001263494.1 NZ_CP098231:c3793125-3792727 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGVFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGVFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1E5WU64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1FJN6 |