Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4644196..4644798 | Replicon | chromosome |
Accession | NZ_CP098229 | ||
Organism | Escherichia coli strain XJ55 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | KFZ57_RS22640 | Protein ID | WP_000897305.1 |
Coordinates | 4644487..4644798 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KFZ57_RS22635 | Protein ID | WP_000356397.1 |
Coordinates | 4644196..4644486 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ57_RS22610 (4640121) | 4640121..4641023 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
KFZ57_RS22615 (4641020) | 4641020..4641655 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
KFZ57_RS22620 (4641652) | 4641652..4642581 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
KFZ57_RS22625 (4642911) | 4642911..4643153 | - | 243 | WP_001087409.1 | protein YiiF | - |
KFZ57_RS22630 (4643373) | 4643373..4643591 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
KFZ57_RS22635 (4644196) | 4644196..4644486 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
KFZ57_RS22640 (4644487) | 4644487..4644798 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
KFZ57_RS22645 (4645027) | 4645027..4645935 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
KFZ57_RS22650 (4645999) | 4645999..4646940 | - | 942 | WP_157913650.1 | fatty acid biosynthesis protein FabY | - |
KFZ57_RS22655 (4646985) | 4646985..4647422 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
KFZ57_RS22660 (4647419) | 4647419..4648291 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
KFZ57_RS22665 (4648285) | 4648285..4648884 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
KFZ57_RS22670 (4648983) | 4648983..4649768 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T247289 WP_000897305.1 NZ_CP098229:c4644798-4644487 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|