Detailed information of TA system TA247282

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2829421..2829641
• Replicon: chromosome
• Accession: NZ_CP098229
• Organism: Escherichia coli strain XJ55

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: KFZ57_RS13990
• Protein ID: WP_000170965.1
• Coordinates: 2829534..2829641 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2829421..2829487 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KFZ57_RS13965	2824700..2826094	-	1395	WP_000086201.1	inverse autotransporter invasin YchO	-
KFZ57_RS13970	2826279..2826632	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
KFZ57_RS13975	2826676..2827371	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
KFZ57_RS13980	2827529..2827759	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
KFZ57_RS13985	2828029..2829129	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2829421..2829487	-	67	-	-	Antitoxin
KFZ57_RS13990	2829534..2829641	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2829954..2830017	-	64	NuclAT_33	-	-
-	2829954..2830017	-	64	NuclAT_33	-	-
-	2829954..2830017	-	64	NuclAT_33	-	-
-	2829954..2830017	-	64	NuclAT_33	-	-
-	2829954..2830017	-	64	NuclAT_35	-	-
-	2829954..2830017	-	64	NuclAT_35	-	-
-	2829954..2830017	-	64	NuclAT_35	-	-
-	2829954..2830017	-	64	NuclAT_35	-	-
-	2829954..2830017	-	64	NuclAT_37	-	-
-	2829954..2830017	-	64	NuclAT_37	-	-
-	2829954..2830017	-	64	NuclAT_37	-	-
-	2829954..2830017	-	64	NuclAT_37	-	-
-	2829954..2830017	-	64	NuclAT_39	-	-
-	2829954..2830017	-	64	NuclAT_39	-	-
-	2829954..2830017	-	64	NuclAT_39	-	-
-	2829954..2830017	-	64	NuclAT_39	-	-
-	2829954..2830017	-	64	NuclAT_41	-	-
-	2829954..2830017	-	64	NuclAT_41	-	-
-	2829954..2830017	-	64	NuclAT_41	-	-
-	2829954..2830017	-	64	NuclAT_41	-	-
-	2829954..2830017	-	64	NuclAT_43	-	-
-	2829954..2830017	-	64	NuclAT_43	-	-
-	2829954..2830017	-	64	NuclAT_43	-	-
-	2829954..2830017	-	64	NuclAT_43	-	-
-	2829955..2830017	-	63	NuclAT_45	-	-
-	2829955..2830017	-	63	NuclAT_45	-	-
-	2829955..2830017	-	63	NuclAT_45	-	-
-	2829955..2830017	-	63	NuclAT_45	-	-
-	2829955..2830017	-	63	NuclAT_48	-	-
-	2829955..2830017	-	63	NuclAT_48	-	-
-	2829955..2830017	-	63	NuclAT_48	-	-
-	2829955..2830017	-	63	NuclAT_48	-	-
-	2829956..2830017	-	62	NuclAT_15	-	-
-	2829956..2830017	-	62	NuclAT_15	-	-
-	2829956..2830017	-	62	NuclAT_15	-	-
-	2829956..2830017	-	62	NuclAT_15	-	-
-	2829956..2830017	-	62	NuclAT_18	-	-
-	2829956..2830017	-	62	NuclAT_18	-	-
-	2829956..2830017	-	62	NuclAT_18	-	-
-	2829956..2830017	-	62	NuclAT_18	-	-
-	2829956..2830017	-	62	NuclAT_21	-	-
-	2829956..2830017	-	62	NuclAT_21	-	-
-	2829956..2830017	-	62	NuclAT_21	-	-
-	2829956..2830017	-	62	NuclAT_21	-	-
-	2829956..2830017	-	62	NuclAT_24	-	-
-	2829956..2830017	-	62	NuclAT_24	-	-
-	2829956..2830017	-	62	NuclAT_24	-	-
-	2829956..2830017	-	62	NuclAT_24	-	-
-	2829956..2830017	-	62	NuclAT_27	-	-
-	2829956..2830017	-	62	NuclAT_27	-	-
-	2829956..2830017	-	62	NuclAT_27	-	-
-	2829956..2830017	-	62	NuclAT_27	-	-
-	2829956..2830017	-	62	NuclAT_30	-	-
-	2829956..2830017	-	62	NuclAT_30	-	-
-	2829956..2830017	-	62	NuclAT_30	-	-
-	2829956..2830017	-	62	NuclAT_30	-	-
KFZ57_RS13995	2830070..2830177	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2830491..2830557	-	67	NuclAT_44	-	-
-	2830491..2830557	-	67	NuclAT_44	-	-
-	2830491..2830557	-	67	NuclAT_44	-	-
-	2830491..2830557	-	67	NuclAT_44	-	-
-	2830491..2830557	-	67	NuclAT_47	-	-
-	2830491..2830557	-	67	NuclAT_47	-	-
-	2830491..2830557	-	67	NuclAT_47	-	-
-	2830491..2830557	-	67	NuclAT_47	-	-
-	2830492..2830555	-	64	NuclAT_16	-	-
-	2830492..2830555	-	64	NuclAT_16	-	-
-	2830492..2830555	-	64	NuclAT_16	-	-
-	2830492..2830555	-	64	NuclAT_16	-	-
-	2830492..2830555	-	64	NuclAT_19	-	-
-	2830492..2830555	-	64	NuclAT_19	-	-
-	2830492..2830555	-	64	NuclAT_19	-	-
-	2830492..2830555	-	64	NuclAT_19	-	-
-	2830492..2830555	-	64	NuclAT_22	-	-
-	2830492..2830555	-	64	NuclAT_22	-	-
-	2830492..2830555	-	64	NuclAT_22	-	-
-	2830492..2830555	-	64	NuclAT_22	-	-
-	2830492..2830555	-	64	NuclAT_25	-	-
-	2830492..2830555	-	64	NuclAT_25	-	-
-	2830492..2830555	-	64	NuclAT_25	-	-
-	2830492..2830555	-	64	NuclAT_25	-	-
-	2830492..2830555	-	64	NuclAT_28	-	-
-	2830492..2830555	-	64	NuclAT_28	-	-
-	2830492..2830555	-	64	NuclAT_28	-	-
-	2830492..2830555	-	64	NuclAT_28	-	-
-	2830492..2830555	-	64	NuclAT_31	-	-
-	2830492..2830555	-	64	NuclAT_31	-	-
-	2830492..2830555	-	64	NuclAT_31	-	-
-	2830492..2830555	-	64	NuclAT_31	-	-
KFZ57_RS14000	2830605..2830712	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
KFZ57_RS14005	2830861..2831715	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
KFZ57_RS14010	2831751..2832560	-	810	WP_001257044.1	invasion regulator SirB1	-
KFZ57_RS14015	2832564..2832956	-	393	WP_000200378.1	invasion regulator SirB2	-
KFZ57_RS14020	2832953..2833786	-	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T247282 WP_000170965.1 NZ_CP098229:2829534-2829641 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT247282 NZ_CP098229:c2829487-2829421 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin