Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 625144..625943 | Replicon | chromosome |
| Accession | NZ_CP098229 | ||
| Organism | Escherichia coli strain XJ55 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F4VJD3 |
| Locus tag | KFZ57_RS03025 | Protein ID | WP_000347266.1 |
| Coordinates | 625144..625608 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | KFZ57_RS03030 | Protein ID | WP_001307405.1 |
| Coordinates | 625608..625943 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ57_RS02995 (620145) | 620145..620579 | - | 435 | WP_074520084.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| KFZ57_RS03000 (620597) | 620597..621475 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| KFZ57_RS03005 (621465) | 621465..622244 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| KFZ57_RS03010 (622255) | 622255..622728 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| KFZ57_RS03015 (622751) | 622751..624031 | - | 1281 | WP_275801508.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| KFZ57_RS03020 (624280) | 624280..625089 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| KFZ57_RS03025 (625144) | 625144..625608 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| KFZ57_RS03030 (625608) | 625608..625943 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| KFZ57_RS03035 (626092) | 626092..627663 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| KFZ57_RS03040 (628038) | 628038..629372 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| KFZ57_RS03045 (629388) | 629388..630158 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 625144..638210 | 13066 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T247269 WP_000347266.1 NZ_CP098229:c625608-625144 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836NGD2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |