Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3792742..3793436 Replicon chromosome
Accession NZ_CP098227
Organism Escherichia coli strain XJ6-3

Toxin (Protein)


Gene name yafO Uniprot ID A0A1E5WU64
Locus tag KFZ54_RS18315 Protein ID WP_001263494.1
Coordinates 3792742..3793140 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag KFZ54_RS18320 Protein ID WP_000554757.1
Coordinates 3793143..3793436 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3788517) 3788517..3788597 - 81 NuclAT_12 - -
- (3788517) 3788517..3788597 - 81 NuclAT_12 - -
- (3788517) 3788517..3788597 - 81 NuclAT_12 - -
- (3788517) 3788517..3788597 - 81 NuclAT_12 - -
KFZ54_RS18285 (3787857) 3787857..3789101 - 1245 WP_000189541.1 esterase FrsA -
KFZ54_RS18290 (3789193) 3789193..3789651 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
KFZ54_RS18295 (3789912) 3789912..3791369 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
KFZ54_RS18300 (3791426) 3791426..3791734 - 309 Protein_3584 peptide chain release factor-like protein -
KFZ54_RS18305 (3791754) 3791754..3791962 - 209 Protein_3585 RtcB family protein -
KFZ54_RS18310 (3792280) 3792280..3792732 - 453 WP_088376518.1 GNAT family N-acetyltransferase -
KFZ54_RS18315 (3792742) 3792742..3793140 - 399 WP_001263494.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
KFZ54_RS18320 (3793143) 3793143..3793436 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
KFZ54_RS18325 (3793488) 3793488..3794543 - 1056 WP_001226164.1 DNA polymerase IV -
KFZ54_RS18330 (3794614) 3794614..3795399 - 786 WP_162859066.1 putative lateral flagellar export/assembly protein LafU -
KFZ54_RS18335 (3795371) 3795371..3797083 + 1713 Protein_3591 flagellar biosynthesis protein FlhA -
KFZ54_RS18340 (3797316) 3797316..3797813 - 498 WP_047625020.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3734341..3793436 59095


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15485.91 Da        Isoelectric Point: 8.0949

>T247260 WP_001263494.1 NZ_CP098227:c3793140-3792742 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGVFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT247260 WP_000554757.1 NZ_CP098227:c3793436-3793143 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1E5WU64

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References