Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 624468..625267 | Replicon | chromosome |
Accession | NZ_CP098227 | ||
Organism | Escherichia coli strain XJ6-3 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | KFZ54_RS03025 | Protein ID | WP_088376472.1 |
Coordinates | 624468..624932 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | KFZ54_RS03030 | Protein ID | WP_001307405.1 |
Coordinates | 624932..625267 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ54_RS02995 (619469) | 619469..619903 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
KFZ54_RS03000 (619921) | 619921..620799 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
KFZ54_RS03005 (620789) | 620789..621568 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
KFZ54_RS03010 (621579) | 621579..622052 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
KFZ54_RS03015 (622075) | 622075..623355 | - | 1281 | WP_000681939.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
KFZ54_RS03020 (623604) | 623604..624413 | + | 810 | WP_000072174.1 | aga operon transcriptional regulator AgaR | - |
KFZ54_RS03025 (624468) | 624468..624932 | - | 465 | WP_088376472.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
KFZ54_RS03030 (624932) | 624932..625267 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
KFZ54_RS03035 (625417) | 625417..626988 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
KFZ54_RS03040 (627363) | 627363..628697 | + | 1335 | WP_097756011.1 | galactarate/glucarate/glycerate transporter GarP | - |
KFZ54_RS03045 (628713) | 628713..629483 | + | 771 | WP_021577990.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17835.31 Da Isoelectric Point: 9.9660
>T247247 WP_088376472.1 NZ_CP098227:c624932-624468 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWKTLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWKTLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|