Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4563411..4563633 | Replicon | chromosome |
| Accession | NZ_CP098223 | ||
| Organism | Escherichia coli strain Z0117EC0005 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | NBY12_RS21885 | Protein ID | WP_000170738.1 |
| Coordinates | 4563411..4563518 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4563567..4563633 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY12_RS21855 | 4558463..4558651 | - | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| NBY12_RS21860 | 4558923..4560494 | + | 1572 | WP_250777500.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NBY12_RS21865 | 4560491..4560682 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| NBY12_RS21870 | 4560679..4562358 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| NBY12_RS21875 | 4562445..4562552 | - | 108 | WP_103253593.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NBY12_RS21880 | 4562928..4563035 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NBY12_RS21885 | 4563411..4563518 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4563567..4563633 | + | 67 | - | - | Antitoxin |
| NBY12_RS21890 | 4563895..4564002 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NBY12_RS21895 | 4564378..4564485 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NBY12_RS21900 | 4564961..4566232 | + | 1272 | WP_001353583.1 | aromatic amino acid transport family protein | - |
| NBY12_RS21905 | 4566262..4567266 | - | 1005 | WP_000107019.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| NBY12_RS21910 | 4567263..4568246 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T247238 WP_000170738.1 NZ_CP098223:c4563518-4563411 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT247238 NZ_CP098223:4563567-4563633 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGCCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGCCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|