Detailed information of TA system TA247238

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4563411..4563633
• Replicon: chromosome
• Accession: NZ_CP098223
• Organism: Escherichia coli strain Z0117EC0005

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: NBY12_RS21885
• Protein ID: WP_000170738.1
• Coordinates: 4563411..4563518 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4563567..4563633 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NBY12_RS21855	4558463..4558651	-	189	WP_001063314.1	cellulose biosynthesis protein BcsR	-
NBY12_RS21860	4558923..4560494	+	1572	WP_250777500.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
NBY12_RS21865	4560491..4560682	+	192	WP_000988308.1	cellulose biosynthesis protein BcsF	-
NBY12_RS21870	4560679..4562358	+	1680	WP_000191596.1	cellulose biosynthesis protein BcsG	-
NBY12_RS21875	4562445..4562552	-	108	WP_103253593.1	type I toxin-antitoxin system toxin Ldr family protein	-
NBY12_RS21880	4562928..4563035	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
NBY12_RS21885	4563411..4563518	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4563567..4563633	+	67	-	-	Antitoxin
NBY12_RS21890	4563895..4564002	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
NBY12_RS21895	4564378..4564485	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
NBY12_RS21900	4564961..4566232	+	1272	WP_001353583.1	aromatic amino acid transport family protein	-
NBY12_RS21905	4566262..4567266	-	1005	WP_000107019.1	dipeptide ABC transporter ATP-binding subunit DppF	-
NBY12_RS21910	4567263..4568246	-	984	WP_001196486.1	dipeptide ABC transporter ATP-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T247238 WP_000170738.1 NZ_CP098223:c4563518-4563411 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT247238 NZ_CP098223:4563567-4563633 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGCCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin