Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4140372..4141171 | Replicon | chromosome |
Accession | NZ_CP098223 | ||
Organism | Escherichia coli strain Z0117EC0005 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | NBY12_RS19775 | Protein ID | WP_000347251.1 |
Coordinates | 4140707..4141171 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | NBY12_RS19770 | Protein ID | WP_001296435.1 |
Coordinates | 4140372..4140707 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY12_RS19755 (4136156) | 4136156..4136926 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NBY12_RS19760 (4136942) | 4136942..4138276 | - | 1335 | WP_032185178.1 | galactarate/glucarate/glycerate transporter GarP | - |
NBY12_RS19765 (4138652) | 4138652..4140223 | + | 1572 | WP_137498661.1 | galactarate dehydratase | - |
NBY12_RS19770 (4140372) | 4140372..4140707 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NBY12_RS19775 (4140707) | 4140707..4141171 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NBY12_RS19780 (4141226) | 4141226..4142035 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NBY12_RS19785 (4142284) | 4142284..4143564 | + | 1281 | WP_032303875.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NBY12_RS19790 (4143587) | 4143587..4144060 | + | 474 | WP_032303829.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NBY12_RS19795 (4144071) | 4144071..4144850 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NBY12_RS19800 (4144840) | 4144840..4145718 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NBY12_RS19805 (4145736) | 4145736..4146170 | + | 435 | WP_032303830.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4131582..4141171 | 9589 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T247236 WP_000347251.1 NZ_CP098223:4140707-4141171 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |