Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4097212..4097939 | Replicon | chromosome |
Accession | NZ_CP098223 | ||
Organism | Escherichia coli strain Z0117EC0005 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2K3TXF2 |
Locus tag | NBY12_RS19550 | Protein ID | WP_032303813.1 |
Coordinates | 4097625..4097939 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY12_RS19545 | Protein ID | WP_000560266.1 |
Coordinates | 4097212..4097628 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY12_RS19535 (4092573) | 4092573..4094924 | + | 2352 | WP_032303811.1 | alpha-glucosidase | - |
NBY12_RS19540 (4095149) | 4095149..4097167 | + | 2019 | WP_050009868.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NBY12_RS19545 (4097212) | 4097212..4097628 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
NBY12_RS19550 (4097625) | 4097625..4097939 | - | 315 | WP_032303813.1 | type II toxin-antitoxin system toxin HigB | Toxin |
NBY12_RS19555 (4098195) | 4098195..4099331 | - | 1137 | WP_000018675.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NBY12_RS19560 (4099416) | 4099416..4099919 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
NBY12_RS19565 (4099997) | 4099997..4100689 | + | 693 | WP_032303814.1 | vancomycin high temperature exclusion protein | - |
NBY12_RS19570 (4100768) | 4100768..4101754 | + | 987 | WP_103253354.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12119.06 Da Isoelectric Point: 9.9056
>T247235 WP_032303813.1 NZ_CP098223:c4097939-4097625 [Escherichia coli]
MHLITQKELKDAAEKYPQHKTELGALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKELKDAAEKYPQHKTELGALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT247235 WP_000560266.1 NZ_CP098223:c4097628-4097212 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|