Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 84435..84677 | Replicon | plasmid pZ0117EC0013-1 |
| Accession | NZ_CP098220 | ||
| Organism | Escherichia coli strain Z0117EC0013 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NBY13_RS24235 | Protein ID | WP_001372321.1 |
| Coordinates | 84435..84560 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 84637..84677 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY13_RS24190 (79547) | 79547..79774 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| NBY13_RS24195 (79862) | 79862..80539 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| NBY13_RS24200 (80673) | 80673..81056 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NBY13_RS24205 (81399) | 81399..81989 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| NBY13_RS24210 (82286) | 82286..83107 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| NBY13_RS24215 (83226) | 83226..83513 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NBY13_RS24220 (83538) | 83538..83744 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| NBY13_RS24225 (83814) | 83814..83987 | + | 174 | Protein_104 | hypothetical protein | - |
| NBY13_RS24230 (83985) | 83985..84215 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| NBY13_RS24235 (84435) | 84435..84560 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NBY13_RS24240 (84502) | 84502..84651 | - | 150 | Protein_107 | plasmid maintenance protein Mok | - |
| - (84637) | 84637..84677 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (84637) | 84637..84677 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (84637) | 84637..84677 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (84637) | 84637..84677 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (86121) | 86121..86307 | - | 187 | NuclAT_0 | - | - |
| - (86121) | 86121..86307 | - | 187 | NuclAT_0 | - | - |
| - (86121) | 86121..86307 | - | 187 | NuclAT_0 | - | - |
| - (86121) | 86121..86307 | - | 187 | NuclAT_0 | - | - |
| NBY13_RS24250 (86276) | 86276..87038 | - | 763 | Protein_109 | plasmid SOS inhibition protein A | - |
| NBY13_RS24255 (87035) | 87035..87469 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| NBY13_RS24260 (87524) | 87524..89482 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | senB | 1..103564 | 103564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T247208 WP_001372321.1 NZ_CP098220:c84560-84435 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT247208 NZ_CP098220:c84677-84637 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
