Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 70619..70857 | Replicon | plasmid pZ0117EC0013-1 |
| Accession | NZ_CP098220 | ||
| Organism | Escherichia coli strain Z0117EC0013 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | NBY13_RS24100 | Protein ID | WP_023144756.1 |
| Coordinates | 70723..70857 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 70619..70678 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY13_RS24080 (66355) | 66355..67366 | - | 1012 | Protein_76 | RepB family plasmid replication initiator protein | - |
| NBY13_RS24085 (68036) | 68036..68740 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NBY13_RS24090 (68793) | 68793..70288 | + | 1496 | Protein_78 | IS66 family transposase | - |
| NBY13_RS24095 (70366) | 70366..70643 | + | 278 | Protein_79 | DUF2726 domain-containing protein | - |
| - (70619) | 70619..70678 | - | 60 | NuclAT_2 | - | Antitoxin |
| - (70619) | 70619..70678 | - | 60 | NuclAT_2 | - | Antitoxin |
| - (70619) | 70619..70678 | - | 60 | NuclAT_2 | - | Antitoxin |
| - (70619) | 70619..70678 | - | 60 | NuclAT_2 | - | Antitoxin |
| NBY13_RS24100 (70723) | 70723..70857 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| NBY13_RS24105 (71154) | 71154..71408 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| NBY13_RS24115 (71644) | 71644..71718 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| NBY13_RS24120 (71711) | 71711..72568 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| NBY13_RS24125 (73504) | 73504..73656 | + | 153 | WP_171004014.1 | hypothetical protein | - |
| NBY13_RS24130 (73704) | 73704..73949 | - | 246 | WP_250838133.1 | hypothetical protein | - |
| NBY13_RS24135 (73966) | 73966..74154 | + | 189 | WP_231550408.1 | CPBP family glutamic-type intramembrane protease | - |
| NBY13_RS24140 (74247) | 74247..74500 | + | 254 | Protein_87 | type II toxin-antitoxin system antitoxin PemI | - |
| NBY13_RS24145 (74469) | 74469..74831 | + | 363 | Protein_88 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NBY13_RS24150 (75222) | 75222..75488 | + | 267 | WP_250838134.1 | DUF262 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | senB | 1..103564 | 103564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T247204 WP_023144756.1 NZ_CP098220:70723-70857 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 60 bp
>AT247204 NZ_CP098220:c70678-70619 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
