Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 4680722..4682040 | Replicon | chromosome |
Accession | NZ_CP098219 | ||
Organism | Escherichia coli strain Z0117EC0013 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | F4T5A3 |
Locus tag | NBY13_RS22620 | Protein ID | WP_001262467.1 |
Coordinates | 4680722..4681729 (-) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | F4T5A4 |
Locus tag | NBY13_RS22625 | Protein ID | WP_001312177.1 |
Coordinates | 4681729..4682040 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY13_RS22590 (4675932) | 4675932..4676123 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
NBY13_RS22595 (4676120) | 4676120..4677799 | + | 1680 | Protein_4412 | cellulose biosynthesis protein BcsG | - |
NBY13_RS22600 (4677885) | 4677885..4677992 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
NBY13_RS22605 (4678368) | 4678368..4678475 | - | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (4678532) | 4678532..4678589 | + | 58 | NuclAT_26 | - | - |
- (4678532) | 4678532..4678589 | + | 58 | NuclAT_26 | - | - |
- (4678532) | 4678532..4678589 | + | 58 | NuclAT_26 | - | - |
- (4678532) | 4678532..4678589 | + | 58 | NuclAT_26 | - | - |
NBY13_RS22610 (4678851) | 4678851..4678958 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (4679007) | 4679007..4679072 | + | 66 | NuclAT_27 | - | - |
- (4679007) | 4679007..4679072 | + | 66 | NuclAT_27 | - | - |
- (4679007) | 4679007..4679072 | + | 66 | NuclAT_27 | - | - |
- (4679007) | 4679007..4679072 | + | 66 | NuclAT_27 | - | - |
NBY13_RS22615 (4679434) | 4679434..4680705 | + | 1272 | WP_001545666.1 | amino acid permease | - |
NBY13_RS22620 (4680722) | 4680722..4681729 | - | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
NBY13_RS22625 (4681729) | 4681729..4682040 | - | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
NBY13_RS22630 (4682025) | 4682025..4682348 | - | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
NBY13_RS22635 (4682573) | 4682573..4683586 | - | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
NBY13_RS22640 (4683583) | 4683583..4684566 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
NBY13_RS22645 (4684577) | 4684577..4685479 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
NBY13_RS22650 (4685489) | 4685489..4686508 | - | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T247202 WP_001262467.1 NZ_CP098219:c4681729-4680722 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3HKE2 |