Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4264995..4265794 | Replicon | chromosome |
Accession | NZ_CP098219 | ||
Organism | Escherichia coli strain Z0117EC0013 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | NBY13_RS20530 | Protein ID | WP_000347251.1 |
Coordinates | 4265330..4265794 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | NBY13_RS20525 | Protein ID | WP_001296435.1 |
Coordinates | 4264995..4265330 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY13_RS20510 (4260780) | 4260780..4261550 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NBY13_RS20515 (4261566) | 4261566..4262900 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NBY13_RS20520 (4263275) | 4263275..4264846 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
NBY13_RS20525 (4264995) | 4264995..4265330 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NBY13_RS20530 (4265330) | 4265330..4265794 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NBY13_RS20535 (4265849) | 4265849..4266658 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NBY13_RS20540 (4266907) | 4266907..4268187 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NBY13_RS20545 (4268210) | 4268210..4268683 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NBY13_RS20550 (4268694) | 4268694..4269473 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NBY13_RS20555 (4269463) | 4269463..4270341 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NBY13_RS20560 (4270359) | 4270359..4270793 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T247200 WP_000347251.1 NZ_CP098219:4265330-4265794 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |