Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1351477..1352156 | Replicon | chromosome |
Accession | NZ_CP098219 | ||
Organism | Escherichia coli strain Z0117EC0013 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | NBY13_RS06335 | Protein ID | WP_000057523.1 |
Coordinates | 1351477..1351779 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NBY13_RS06340 | Protein ID | WP_000806442.1 |
Coordinates | 1351815..1352156 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY13_RS06310 (1346853) | 1346853..1348505 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NBY13_RS06315 (1348543) | 1348543..1349046 | - | 504 | WP_000667000.1 | hypothetical protein | - |
NBY13_RS06320 (1349043) | 1349043..1349843 | - | 801 | WP_000439798.1 | hypothetical protein | - |
NBY13_RS06325 (1349867) | 1349867..1350346 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NBY13_RS06330 (1350550) | 1350550..1351344 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
NBY13_RS06335 (1351477) | 1351477..1351779 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY13_RS06340 (1351815) | 1351815..1352156 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NBY13_RS06345 (1352214) | 1352214..1354718 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
NBY13_RS06350 (1354980) | 1354980..1355912 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T247185 WP_000057523.1 NZ_CP098219:1351477-1351779 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|