Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2341300..2341671 | Replicon | chromosome |
| Accession | NZ_CP098217 | ||
| Organism | Escherichia coli strain Z0117EC0032 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | NBY14_RS11110 | Protein ID | WP_001317028.1 |
| Coordinates | 2341477..2341671 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2341300..2341478 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY14_RS24500 (2337052) | 2337052..2337225 | + | 174 | WP_001296046.1 | protein YnaL | - |
| NBY14_RS11085 (2337255) | 2337255..2338628 | + | 1374 | WP_001551034.1 | ATP-dependent RNA helicase DbpA | - |
| NBY14_RS11090 (2338757) | 2338757..2339692 | - | 936 | WP_000662472.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| NBY14_RS11095 (2339744) | 2339744..2340979 | - | 1236 | WP_001551035.1 | site-specific integrase | - |
| NBY14_RS11100 (2340981) | 2340981..2341196 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2341300) | 2341300..2341478 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2341300) | 2341300..2341478 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2341300) | 2341300..2341478 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2341300) | 2341300..2341478 | + | 179 | NuclAT_0 | - | Antitoxin |
| NBY14_RS11105 (2341296) | 2341296..2341484 | - | 189 | WP_001551036.1 | DUF1187 family protein | - |
| NBY14_RS11110 (2341477) | 2341477..2341671 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| NBY14_RS11115 (2341728) | 2341728..2342537 | - | 810 | WP_001551037.1 | recombination protein RecT | - |
| NBY14_RS11120 (2342530) | 2342530..2345181 | - | 2652 | WP_001551038.1 | exodeoxyribonuclease VIII | - |
| NBY14_RS11125 (2345283) | 2345283..2345558 | - | 276 | WP_001314664.1 | hypothetical protein | - |
| NBY14_RS11130 (2345633) | 2345633..2345803 | - | 171 | WP_001551041.1 | YdaE family protein | - |
| NBY14_RS11135 (2345803) | 2345803..2346024 | - | 222 | WP_000560221.1 | killing protein KilR | - |
| NBY14_RS11140 (2346445) | 2346445..2346597 | - | 153 | WP_001551042.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2339744..2387034 | 47290 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T247161 WP_001317028.1 NZ_CP098217:c2341671-2341477 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT247161 NZ_CP098217:2341300-2341478 [Escherichia coli]
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
