Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 1143202..1143896 Replicon chromosome
Accession NZ_CP098217
Organism Escherichia coli strain Z0117EC0032

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NBY14_RS05390 Protein ID WP_001263491.1
Coordinates 1143498..1143896 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NBY14_RS05385 Protein ID WP_000554755.1
Coordinates 1143202..1143495 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY14_RS05360 (1138823) 1138823..1139179 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
NBY14_RS05365 (1139172) 1139172..1139450 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NBY14_RS05370 (1139555) 1139555..1141267 - 1713 Protein_1031 flagellar biosynthesis protein FlhA -
NBY14_RS05375 (1141239) 1141239..1142024 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NBY14_RS05380 (1142095) 1142095..1143150 + 1056 WP_001550655.1 DNA polymerase IV -
NBY14_RS05385 (1143202) 1143202..1143495 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NBY14_RS05390 (1143498) 1143498..1143896 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NBY14_RS05395 (1143906) 1143906..1144358 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
NBY14_RS05400 (1144604) 1144604..1144810 + 207 Protein_1037 RtcB family protein -
NBY14_RS05405 (1144806) 1144806..1145158 + 353 Protein_1038 peptide chain release factor H -
NBY14_RS05410 (1145215) 1145215..1146672 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NBY14_RS05415 (1146933) 1146933..1147391 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (1147987) 1147987..1148067 + 81 NuclAT_11 - -
- (1147987) 1147987..1148067 + 81 NuclAT_11 - -
- (1147987) 1147987..1148067 + 81 NuclAT_11 - -
- (1147987) 1147987..1148067 + 81 NuclAT_11 - -
NBY14_RS05420 (1147483) 1147483..1148727 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T247156 WP_001263491.1 NZ_CP098217:1143498-1143896 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT247156 WP_000554755.1 NZ_CP098217:1143202-1143495 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References