Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1143202..1143896 | Replicon | chromosome |
| Accession | NZ_CP098217 | ||
| Organism | Escherichia coli strain Z0117EC0032 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NBY14_RS05390 | Protein ID | WP_001263491.1 |
| Coordinates | 1143498..1143896 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NBY14_RS05385 | Protein ID | WP_000554755.1 |
| Coordinates | 1143202..1143495 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY14_RS05360 (1138823) | 1138823..1139179 | - | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NBY14_RS05365 (1139172) | 1139172..1139450 | - | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NBY14_RS05370 (1139555) | 1139555..1141267 | - | 1713 | Protein_1031 | flagellar biosynthesis protein FlhA | - |
| NBY14_RS05375 (1141239) | 1141239..1142024 | + | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| NBY14_RS05380 (1142095) | 1142095..1143150 | + | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| NBY14_RS05385 (1143202) | 1143202..1143495 | + | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NBY14_RS05390 (1143498) | 1143498..1143896 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NBY14_RS05395 (1143906) | 1143906..1144358 | + | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| NBY14_RS05400 (1144604) | 1144604..1144810 | + | 207 | Protein_1037 | RtcB family protein | - |
| NBY14_RS05405 (1144806) | 1144806..1145158 | + | 353 | Protein_1038 | peptide chain release factor H | - |
| NBY14_RS05410 (1145215) | 1145215..1146672 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NBY14_RS05415 (1146933) | 1146933..1147391 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (1147987) | 1147987..1148067 | + | 81 | NuclAT_11 | - | - |
| - (1147987) | 1147987..1148067 | + | 81 | NuclAT_11 | - | - |
| - (1147987) | 1147987..1148067 | + | 81 | NuclAT_11 | - | - |
| - (1147987) | 1147987..1148067 | + | 81 | NuclAT_11 | - | - |
| NBY14_RS05420 (1147483) | 1147483..1148727 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T247156 WP_001263491.1 NZ_CP098217:1143498-1143896 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |