Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 107564..107818 | Replicon | plasmid pZ0117EC0036-1 |
| Accession | NZ_CP098215 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NBY15_RS25190 | Protein ID | WP_001312851.1 |
| Coordinates | 107669..107818 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 107564..107625 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS25165 (104312) | 104312..105058 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| NBY15_RS25170 (105117) | 105117..105977 | + | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| NBY15_RS25175 (106080) | 106080..106640 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NBY15_RS25180 (106776) | 106776..106988 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NBY15_RS25185 (107234) | 107234..107308 | + | 75 | Protein_127 | endonuclease | - |
| - (107564) | 107564..107625 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (107564) | 107564..107625 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (107564) | 107564..107625 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (107564) | 107564..107625 | - | 62 | NuclAT_1 | - | Antitoxin |
| NBY15_RS25190 (107669) | 107669..107818 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NBY15_RS25195 (108102) | 108102..108359 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NBY15_RS25200 (108376) | 108376..108627 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| NBY15_RS25205 (108618) | 108618..108665 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| NBY15_RS25210 (108658) | 108658..109140 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| NBY15_RS25215 (109133) | 109133..109990 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NBY15_RS25220 (110929) | 110929..111582 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NBY15_RS25225 (111675) | 111675..111932 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NBY15_RS25230 (111865) | 111865..112266 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / sitABCD / blaTEM-1B / aac(3)-IId / blaCTX-M-65 | iucA / iucB / iucC / iucD / iutA / iroC / iroC / iroC / iroD / iroD / iroE / iroN | 1..157136 | 157136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T247149 WP_001312851.1 NZ_CP098215:107669-107818 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT247149 NZ_CP098215:c107625-107564 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
