Detailed information of TA system TA247145

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 69059..69485
• Replicon: plasmid pZ0117EC0036-1
• Accession: NZ_CP098215
• Organism: Escherichia coli strain Z0117EC0036

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NBY15_RS24955
• Protein ID: WP_001372321.1
• Coordinates: 69360..69485 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	69059..69283 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NBY15_RS24900 (64435)	64435..65406	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
NBY15_RS24905 (66043)	66043..66212	+	170	Protein_71	hypothetical protein	-
NBY15_RS24910 (66395)	66395..66475	-	81	Protein_72	hypothetical protein	-
NBY15_RS24915 (66545)	66545..66751	+	207	WP_000275856.1	hypothetical protein	-
NBY15_RS24920 (66777)	66777..67316	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
NBY15_RS24925 (67384)	67384..67617	+	234	WP_000005987.1	DUF905 family protein	-
NBY15_RS24930 (67645)	67645..67842	+	198	Protein_76	hypothetical protein	-
NBY15_RS24935 (67897)	67897..68331	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NBY15_RS24940 (68328)	68328..69090	+	763	Protein_78	plasmid SOS inhibition protein A	-
NBY15_RS24945 (69059)	69059..69247	-	189	WP_001299721.1	hypothetical protein	-
- (69059)	69059..69283	+	225	NuclAT_0	-	Antitoxin
- (69059)	69059..69283	+	225	NuclAT_0	-	Antitoxin
- (69059)	69059..69283	+	225	NuclAT_0	-	Antitoxin
- (69059)	69059..69283	+	225	NuclAT_0	-	Antitoxin
NBY15_RS24950 (69269)	69269..69418	+	150	Protein_80	plasmid maintenance protein Mok	-
NBY15_RS24955 (69360)	69360..69485	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NBY15_RS24960 (69705)	69705..69935	+	231	WP_071586998.1	hypothetical protein	-
NBY15_RS24965 (69933)	69933..70105	-	173	Protein_83	hypothetical protein	-
NBY15_RS24970 (70175)	70175..70381	+	207	WP_000547968.1	hypothetical protein	-
NBY15_RS24975 (70406)	70406..70693	+	288	WP_000107535.1	hypothetical protein	-
NBY15_RS24980 (70811)	70811..71632	+	822	WP_001234426.1	DUF932 domain-containing protein	-
NBY15_RS24985 (71929)	71929..72519	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
NBY15_RS24990 (72852)	72852..73235	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NBY15_RS24995 (73422)	73422..74111	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / sitABCD / blaTEM-1B / aac(3)-IId / blaCTX-M-65	iucA / iucB / iucC / iucD / iutA / iroC / iroC / iroC / iroD / iroD / iroE / iroN	1..157136	157136

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T247145 WP_001372321.1 NZ_CP098215:69360-69485 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT247145 NZ_CP098215:69059-69283 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin