Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4885399..4886001 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | NBY15_RS23695 | Protein ID | WP_000897302.1 |
| Coordinates | 4885690..4886001 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBY15_RS23690 | Protein ID | WP_000356397.1 |
| Coordinates | 4885399..4885689 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS23665 (4881464) | 4881464..4882366 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NBY15_RS23670 (4882363) | 4882363..4882998 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NBY15_RS23675 (4882995) | 4882995..4883924 | + | 930 | WP_001553788.1 | formate dehydrogenase accessory protein FdhE | - |
| NBY15_RS23680 (4884148) | 4884148..4884366 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| NBY15_RS23685 (4884762) | 4884762..4885040 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| NBY15_RS23690 (4885399) | 4885399..4885689 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NBY15_RS23695 (4885690) | 4885690..4886001 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| NBY15_RS23700 (4886231) | 4886231..4887139 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| NBY15_RS23705 (4887203) | 4887203..4888144 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NBY15_RS23710 (4888189) | 4888189..4888626 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NBY15_RS23715 (4888623) | 4888623..4889495 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NBY15_RS23720 (4889489) | 4889489..4890088 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| NBY15_RS23725 (4890187) | 4890187..4890972 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T247144 WP_000897302.1 NZ_CP098214:c4886001-4885690 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|