Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 4211599..4212011 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | NBY15_RS20620 | Protein ID | WP_000132614.1 |
| Coordinates | 4211670..4212011 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 4211599..4211675 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS20610 (4208274) | 4208274..4209743 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
| NBY15_RS20615 (4209743) | 4209743..4211449 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4211599) | 4211599..4211675 | - | 77 | NuclAT_7 | - | Antitoxin |
| NBY15_RS20620 (4211670) | 4211670..4212011 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| NBY15_RS20625 (4212058) | 4212058..4213221 | - | 1164 | WP_225377659.1 | DUF1524 domain-containing protein | - |
| NBY15_RS20630 (4213269) | 4213269..4214151 | - | 883 | Protein_4047 | DUF262 domain-containing protein | - |
| NBY15_RS20635 (4214557) | 4214557..4215477 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| NBY15_RS20640 (4215662) | 4215662..4216942 | + | 1281 | WP_021520478.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4195469..4214214 | 18745 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T247137 WP_000132614.1 NZ_CP098214:4211670-4212011 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT247137 NZ_CP098214:c4211675-4211599 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|