Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3860030..3860724 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | NBY15_RS18965 | Protein ID | WP_001263500.1 |
| Coordinates | 3860030..3860428 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | NBY15_RS18970 | Protein ID | WP_000554758.1 |
| Coordinates | 3860431..3860724 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS18940 (3855396) | 3855396..3855854 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| NBY15_RS18945 (3856115) | 3856115..3857572 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| NBY15_RS18950 (3857629) | 3857629..3858243 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| NBY15_RS18955 (3858240) | 3858240..3859379 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| NBY15_RS18960 (3859568) | 3859568..3860020 | - | 453 | WP_001059897.1 | GNAT family N-acetyltransferase | - |
| NBY15_RS18965 (3860030) | 3860030..3860428 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NBY15_RS18970 (3860431) | 3860431..3860724 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NBY15_RS18975 (3860776) | 3860776..3861831 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| NBY15_RS18980 (3861902) | 3861902..3862687 | - | 786 | WP_000207578.1 | putative lateral flagellar export/assembly protein LafU | - |
| NBY15_RS18985 (3862659) | 3862659..3864371 | + | 1713 | Protein_3727 | flagellar biosynthesis protein FlhA | - |
| NBY15_RS18990 (3864450) | 3864450..3864695 | + | 246 | WP_133258463.1 | hypothetical protein | - |
| NBY15_RS18995 (3864690) | 3864690..3865187 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3860030..3880383 | 20353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T247135 WP_001263500.1 NZ_CP098214:c3860428-3860030 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|