Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42345..42609 | Replicon | plasmid pZ0117EC0040-1 |
| Accession | NZ_CP098212 | ||
| Organism | Escherichia coli strain Z0117EC0040 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | NBY16_RS23535 | Protein ID | WP_001303307.1 |
| Coordinates | 42457..42609 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 42345..42407 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY16_RS23520 (38447) | 38447..39517 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| NBY16_RS23525 (39536) | 39536..40744 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (40924) | 40924..40984 | - | 61 | NuclAT_1 | - | - |
| - (40924) | 40924..40984 | - | 61 | NuclAT_1 | - | - |
| - (40924) | 40924..40984 | - | 61 | NuclAT_1 | - | - |
| - (40924) | 40924..40984 | - | 61 | NuclAT_1 | - | - |
| NBY16_RS23530 (41051) | 41051..41830 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (42345) | 42345..42407 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (42345) | 42345..42407 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (42345) | 42345..42407 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (42345) | 42345..42407 | - | 63 | NuclAT_0 | - | Antitoxin |
| NBY16_RS23535 (42457) | 42457..42609 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| NBY16_RS23540 (42681) | 42681..42932 | - | 252 | WP_001291968.1 | hypothetical protein | - |
| - (43319) | 43319..43370 | - | 52 | NuclAT_2 | - | - |
| - (43319) | 43319..43370 | - | 52 | NuclAT_2 | - | - |
| - (43319) | 43319..43370 | - | 52 | NuclAT_2 | - | - |
| - (43319) | 43319..43370 | - | 52 | NuclAT_2 | - | - |
| NBY16_RS23545 (43921) | 43921..45090 | + | 1170 | Protein_52 | IS3-like element ISEc52 family transposase | - |
| NBY16_RS23550 (45109) | 45109..45285 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| NBY16_RS23555 (45494) | 45494..45703 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| NBY16_RS23560 (45801) | 45801..46415 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 / blaCTX-M-14 / blaLAP-2 / qnrS1 / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..115561 | 115561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T247116 WP_001303307.1 NZ_CP098212:42457-42609 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT247116 NZ_CP098212:c42407-42345 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
