Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4684375..4684977 | Replicon | chromosome |
Accession | NZ_CP098211 | ||
Organism | Escherichia coli strain Z0117EC0040 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NBY16_RS22535 | Protein ID | WP_000897305.1 |
Coordinates | 4684666..4684977 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY16_RS22530 | Protein ID | WP_000356397.1 |
Coordinates | 4684375..4684665 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY16_RS22505 (4680301) | 4680301..4681203 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NBY16_RS22510 (4681200) | 4681200..4681835 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY16_RS22515 (4681832) | 4681832..4682761 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NBY16_RS22520 (4683091) | 4683091..4683333 | - | 243 | WP_001086388.1 | protein YiiF | - |
NBY16_RS22525 (4683552) | 4683552..4683770 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NBY16_RS22530 (4684375) | 4684375..4684665 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NBY16_RS22535 (4684666) | 4684666..4684977 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NBY16_RS22540 (4685206) | 4685206..4686114 | + | 909 | WP_048963532.1 | alpha/beta hydrolase | - |
NBY16_RS22545 (4686178) | 4686178..4687119 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NBY16_RS22550 (4687164) | 4687164..4687601 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NBY16_RS22555 (4687598) | 4687598..4688470 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NBY16_RS22560 (4688464) | 4688464..4689063 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T247115 WP_000897305.1 NZ_CP098211:c4684977-4684666 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|