Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4376618..4377417 | Replicon | chromosome |
| Accession | NZ_CP098210 | ||
| Organism | Escherichia coli strain Z0117EC0051 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NBY17_RS20845 | Protein ID | WP_000347270.1 |
| Coordinates | 4376953..4377417 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
| Locus tag | NBY17_RS20840 | Protein ID | WP_001551693.1 |
| Coordinates | 4376618..4376953 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY17_RS20825 (4372403) | 4372403..4373173 | - | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NBY17_RS20830 (4373189) | 4373189..4374523 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NBY17_RS20835 (4374898) | 4374898..4376469 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| NBY17_RS20840 (4376618) | 4376618..4376953 | + | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NBY17_RS20845 (4376953) | 4376953..4377417 | + | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NBY17_RS20850 (4377472) | 4377472..4378281 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NBY17_RS20855 (4378530) | 4378530..4379810 | + | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NBY17_RS20860 (4379833) | 4379833..4380306 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NBY17_RS20865 (4380317) | 4380317..4381096 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NBY17_RS20870 (4381086) | 4381086..4381964 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NBY17_RS20875 (4381982) | 4381982..4382416 | + | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul2 / aph(6)-Id / aph(3'')-Ib | - | 4350882..4377417 | 26535 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T247094 WP_000347270.1 NZ_CP098210:4376953-4377417 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NQ90 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9H1L4 |