Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3944650..3945344 Replicon chromosome
Accession NZ_CP098210
Organism Escherichia coli strain Z0117EC0051

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NBY17_RS18680 Protein ID WP_001263491.1
Coordinates 3944650..3945048 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NBY17_RS18685 Protein ID WP_000554755.1
Coordinates 3945051..3945344 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3940479) 3940479..3940559 - 81 NuclAT_8 - -
- (3940479) 3940479..3940559 - 81 NuclAT_8 - -
- (3940479) 3940479..3940559 - 81 NuclAT_8 - -
- (3940479) 3940479..3940559 - 81 NuclAT_8 - -
NBY17_RS18650 (3939819) 3939819..3941063 - 1245 WP_000189541.1 esterase FrsA -
NBY17_RS18655 (3941155) 3941155..3941613 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NBY17_RS18660 (3941874) 3941874..3943331 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NBY17_RS18665 (3943388) 3943388..3943740 - 353 Protein_3656 peptide chain release factor H -
NBY17_RS18670 (3943736) 3943736..3943942 - 207 Protein_3657 RtcB family protein -
NBY17_RS18675 (3944188) 3944188..3944640 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NBY17_RS18680 (3944650) 3944650..3945048 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NBY17_RS18685 (3945051) 3945051..3945344 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NBY17_RS18690 (3945396) 3945396..3946451 - 1056 WP_001550655.1 DNA polymerase IV -
NBY17_RS18695 (3946522) 3946522..3947307 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NBY17_RS18700 (3947279) 3947279..3948991 + 1713 Protein_3663 flagellar biosynthesis protein FlhA -
NBY17_RS18705 (3949096) 3949096..3949374 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NBY17_RS18710 (3949367) 3949367..3949723 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3934586..3945344 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T247093 WP_001263491.1 NZ_CP098210:c3945048-3944650 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT247093 WP_000554755.1 NZ_CP098210:c3945344-3945051 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References