Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 173834..174436 | Replicon | chromosome |
| Accession | NZ_CP098210 | ||
| Organism | Escherichia coli strain Z0117EC0051 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NBY17_RS00755 | Protein ID | WP_000897305.1 |
| Coordinates | 173834..174145 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBY17_RS00760 | Protein ID | WP_000356395.1 |
| Coordinates | 174146..174436 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY17_RS00730 (168876) | 168876..169313 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NBY17_RS00735 (169358) | 169358..170299 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NBY17_RS00740 (170715) | 170715..171602 | + | 888 | Protein_142 | hypothetical protein | - |
| NBY17_RS00745 (171615) | 171615..172529 | + | 915 | WP_109553727.1 | transposase | - |
| NBY17_RS00750 (172697) | 172697..173605 | - | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| NBY17_RS00755 (173834) | 173834..174145 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NBY17_RS00760 (174146) | 174146..174436 | + | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| NBY17_RS00765 (174521) | 174521..174742 | + | 222 | WP_001550354.1 | hypothetical protein | - |
| NBY17_RS00770 (174794) | 174794..175072 | + | 279 | WP_001315112.1 | hypothetical protein | - |
| NBY17_RS00775 (175491) | 175491..175709 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NBY17_RS00780 (175928) | 175928..176170 | + | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| NBY17_RS00785 (176352) | 176352..177281 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NBY17_RS00790 (177278) | 177278..177913 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NBY17_RS00795 (177910) | 177910..178812 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T247075 WP_000897305.1 NZ_CP098210:173834-174145 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|