Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4860161..4860763 | Replicon | chromosome |
Accession | NZ_CP098206 | ||
Organism | Escherichia coli strain Z0117EC0054 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | NBY18_RS23785 | Protein ID | WP_000897302.1 |
Coordinates | 4860452..4860763 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY18_RS23780 | Protein ID | WP_000356397.1 |
Coordinates | 4860161..4860451 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY18_RS23755 (4856234) | 4856234..4857136 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NBY18_RS23760 (4857133) | 4857133..4857768 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY18_RS23765 (4857765) | 4857765..4858694 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NBY18_RS23770 (4858910) | 4858910..4859128 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
NBY18_RS23775 (4859524) | 4859524..4859802 | - | 279 | WP_001296612.1 | hypothetical protein | - |
NBY18_RS23780 (4860161) | 4860161..4860451 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NBY18_RS23785 (4860452) | 4860452..4860763 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
NBY18_RS23790 (4860992) | 4860992..4861900 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
NBY18_RS23795 (4861964) | 4861964..4862905 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NBY18_RS23800 (4862950) | 4862950..4863387 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NBY18_RS23805 (4863384) | 4863384..4864256 | - | 873 | WP_000920754.1 | virulence factor BrkB family protein | - |
NBY18_RS23810 (4864250) | 4864250..4864849 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T247072 WP_000897302.1 NZ_CP098206:c4860763-4860452 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|