Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3898345..3899039 | Replicon | chromosome |
Accession | NZ_CP098206 | ||
Organism | Escherichia coli strain Z0117EC0054 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | NBY18_RS19150 | Protein ID | WP_001263500.1 |
Coordinates | 3898345..3898743 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NBY18_RS19155 | Protein ID | WP_000554758.1 |
Coordinates | 3898746..3899039 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY18_RS19125 (3893710) | 3893710..3894168 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
NBY18_RS19130 (3894429) | 3894429..3895886 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
NBY18_RS19135 (3895943) | 3895943..3896557 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
NBY18_RS19140 (3896554) | 3896554..3897693 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
NBY18_RS19145 (3897883) | 3897883..3898335 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
NBY18_RS19150 (3898345) | 3898345..3898743 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NBY18_RS19155 (3898746) | 3898746..3899039 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NBY18_RS19160 (3899091) | 3899091..3900146 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
NBY18_RS19165 (3900217) | 3900217..3901002 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
NBY18_RS19170 (3900974) | 3900974..3902686 | + | 1713 | Protein_3759 | flagellar biosynthesis protein FlhA | - |
NBY18_RS19175 (3902765) | 3902765..3902923 | + | 159 | WP_014639450.1 | hypothetical protein | - |
NBY18_RS19180 (3903006) | 3903006..3903503 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3898345..3918699 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T247067 WP_001263500.1 NZ_CP098206:c3898743-3898345 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|