Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3655925..3656604 | Replicon | chromosome |
Accession | NZ_CP098206 | ||
Organism | Escherichia coli strain Z0117EC0054 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | NBY18_RS18005 | Protein ID | WP_000057524.1 |
Coordinates | 3656302..3656604 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NBY18_RS18000 | Protein ID | WP_000806442.1 |
Coordinates | 3655925..3656266 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY18_RS17990 (3652169) | 3652169..3653101 | - | 933 | WP_000883052.1 | glutaminase A | - |
NBY18_RS17995 (3653363) | 3653363..3655867 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
NBY18_RS18000 (3655925) | 3655925..3656266 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NBY18_RS18005 (3656302) | 3656302..3656604 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY18_RS18010 (3656737) | 3656737..3657531 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
NBY18_RS18015 (3657735) | 3657735..3658214 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NBY18_RS18020 (3658238) | 3658238..3659038 | + | 801 | WP_000439796.1 | hypothetical protein | - |
NBY18_RS18025 (3659035) | 3659035..3659538 | + | 504 | WP_000667000.1 | hypothetical protein | - |
NBY18_RS18030 (3659576) | 3659576..3661228 | - | 1653 | WP_000771762.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3648614..3659538 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T247065 WP_000057524.1 NZ_CP098206:c3656604-3656302 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|