Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 58175..58428 | Replicon | plasmid pZ0117ECO055-1 |
| Accession | NZ_CP098204 | ||
| Organism | Escherichia coli strain Z0117EC0055 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NBY19_RS24570 | Protein ID | WP_001312851.1 |
| Coordinates | 58279..58428 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 58175..58234 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY19_RS24535 (53951) | 53951..54811 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
| NBY19_RS24540 (54914) | 54914..55474 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
| NBY19_RS24545 (55603) | 55603..55815 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
| NBY19_RS24550 (56060) | 56060..56521 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| NBY19_RS24555 (56567) | 56567..56776 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| NBY19_RS24560 (56814) | 56814..57404 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| NBY19_RS24565 (57559) | 57559..58032 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - (58175) | 58175..58234 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (58175) | 58175..58234 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (58175) | 58175..58234 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (58175) | 58175..58234 | - | 60 | NuclAT_1 | - | Antitoxin |
| NBY19_RS24570 (58279) | 58279..58428 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NBY19_RS24575 (58713) | 58713..58961 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| NBY19_RS24580 (59206) | 59206..59280 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| NBY19_RS24585 (59273) | 59273..60130 | + | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| NBY19_RS24590 (61040) | 61040..61177 | + | 138 | Protein_81 | XRE family transcriptional regulator | - |
| NBY19_RS24595 (61197) | 61197..61460 | + | 264 | WP_001089473.1 | hypothetical protein | - |
| NBY19_RS24600 (61450) | 61450..61749 | + | 300 | WP_001528606.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NBY19_RS24605 (61785) | 61785..62450 | - | 666 | WP_001535733.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..68004 | 68004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T247050 WP_001312851.1 NZ_CP098204:58279-58428 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT247050 NZ_CP098204:c58234-58175 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|