Detailed information of TA system TA247048

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 16676..16945
• Replicon: plasmid pZ0117ECO055-1
• Accession: NZ_CP098204
• Organism: Escherichia coli strain Z0117EC0055

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NBY19_RS24320
• Protein ID: WP_001372321.1
• Coordinates: 16820..16945 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	16676..16741 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NBY19_RS24280	12406..12933	+	528	WP_000290833.1	single-stranded DNA-binding protein	-
NBY19_RS24285	12990..13224	+	235	Protein_20	DUF905 family protein	-
NBY19_RS24290	13286..15270	+	1985	Protein_21	ParB/RepB/Spo0J family partition protein	-
NBY19_RS24295	15375..15629	+	255	WP_250844077.1	conjugation system SOS inhibitor PsiB family protein	-
NBY19_RS24300	15550..15777	+	228	Protein_23	conjugation system SOS inhibitor PsiB family protein	-
NBY19_RS24305	15796..16550	+	755	Protein_24	plasmid SOS inhibition protein A	-
-	16519..16743	+	225	NuclAT_0	-	-
-	16519..16743	+	225	NuclAT_0	-	-
-	16519..16743	+	225	NuclAT_0	-	-
-	16519..16743	+	225	NuclAT_0	-	-
NBY19_RS24310	16528..16707	-	180	WP_001309233.1	hypothetical protein	-
-	16676..16741	-	66	-	-	Antitoxin
NBY19_RS24315	16729..16878	+	150	Protein_26	plasmid maintenance protein Mok	-
NBY19_RS24320	16820..16945	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NBY19_RS24325	17264..17561	-	298	Protein_28	hypothetical protein	-
NBY19_RS24330	17861..18157	+	297	WP_001272251.1	hypothetical protein	-
NBY19_RS24335	18268..19099	+	832	Protein_30	DUF932 domain-containing protein	-
NBY19_RS24340	19388..19980	-	593	Protein_31	transglycosylase SLT domain-containing protein	-
NBY19_RS24345	20325..20708	+	384	WP_250844075.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NBY19_RS24350	20900..21562	+	663	WP_250844076.1	conjugal transfer protein TrbJ	-
NBY19_RS24355	21666..21893	+	228	WP_000589556.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..68004	68004

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T247048 WP_001372321.1 NZ_CP098204:16820-16945 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT247048 NZ_CP098204:c16741-16676 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin