Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 227109..228427 | Replicon | chromosome |
Accession | NZ_CP098203 | ||
Organism | Escherichia coli strain Z0117EC0055 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | F4T5A3 |
Locus tag | NBY19_RS01085 | Protein ID | WP_001262467.1 |
Coordinates | 227420..228427 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | F4T5A4 |
Locus tag | NBY19_RS01080 | Protein ID | WP_001312177.1 |
Coordinates | 227109..227420 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY19_RS01050 (222396) | 222396..222623 | - | 228 | WP_000198577.1 | hypothetical protein | - |
NBY19_RS01055 (222641) | 222641..223660 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
NBY19_RS01060 (223670) | 223670..224572 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
NBY19_RS01065 (224583) | 224583..225566 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
NBY19_RS01070 (225563) | 225563..226576 | + | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
NBY19_RS01075 (226801) | 226801..227124 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
NBY19_RS01080 (227109) | 227109..227420 | + | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
NBY19_RS01085 (227420) | 227420..228427 | + | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
NBY19_RS01090 (228444) | 228444..229715 | - | 1272 | WP_001545666.1 | amino acid permease | - |
- (230077) | 230077..230142 | - | 66 | NuclAT_27 | - | - |
- (230077) | 230077..230142 | - | 66 | NuclAT_27 | - | - |
- (230077) | 230077..230142 | - | 66 | NuclAT_27 | - | - |
- (230077) | 230077..230142 | - | 66 | NuclAT_27 | - | - |
NBY19_RS01095 (230191) | 230191..230298 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (230560) | 230560..230617 | - | 58 | NuclAT_26 | - | - |
- (230560) | 230560..230617 | - | 58 | NuclAT_26 | - | - |
- (230560) | 230560..230617 | - | 58 | NuclAT_26 | - | - |
- (230560) | 230560..230617 | - | 58 | NuclAT_26 | - | - |
NBY19_RS01100 (230674) | 230674..230781 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
NBY19_RS01105 (231157) | 231157..231264 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
NBY19_RS01110 (231350) | 231350..233029 | - | 1680 | Protein_219 | cellulose biosynthesis protein BcsG | - |
NBY19_RS01115 (233026) | 233026..233217 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T247027 WP_001262467.1 NZ_CP098203:227420-228427 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3HKE2 |