Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4489242..4490041 | Replicon | chromosome |
| Accession | NZ_CP098201 | ||
| Organism | Escherichia coli strain Z0117EC0056 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NBY20_RS21570 | Protein ID | WP_000347270.1 |
| Coordinates | 4489577..4490041 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
| Locus tag | NBY20_RS21565 | Protein ID | WP_001551693.1 |
| Coordinates | 4489242..4489577 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY20_RS21550 (4485027) | 4485027..4485797 | - | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NBY20_RS21555 (4485813) | 4485813..4487147 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NBY20_RS21560 (4487522) | 4487522..4489093 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| NBY20_RS21565 (4489242) | 4489242..4489577 | + | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NBY20_RS21570 (4489577) | 4489577..4490041 | + | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NBY20_RS21575 (4490096) | 4490096..4490905 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NBY20_RS21580 (4491154) | 4491154..4492434 | + | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NBY20_RS21585 (4492457) | 4492457..4492930 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NBY20_RS21590 (4492941) | 4492941..4493720 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NBY20_RS21595 (4493710) | 4493710..4494588 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NBY20_RS21600 (4494606) | 4494606..4495040 | + | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4480480..4490041 | 9561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T247021 WP_000347270.1 NZ_CP098201:4489577-4490041 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NQ90 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9H1L4 |