Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3915819..3916546 | Replicon | chromosome |
| Accession | NZ_CP098201 | ||
| Organism | Escherichia coli strain Z0117EC0056 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | NBY20_RS18805 | Protein ID | WP_000547555.1 |
| Coordinates | 3916235..3916546 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBY20_RS18800 | Protein ID | WP_000126294.1 |
| Coordinates | 3915819..3916238 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY20_RS18780 (3910904) | 3910904..3911431 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| NBY20_RS18785 (3911580) | 3911580..3912590 | - | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| NBY20_RS18790 (3912850) | 3912850..3914307 | + | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NBY20_RS18795 (3914316) | 3914316..3915740 | + | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| NBY20_RS18800 (3915819) | 3915819..3916238 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NBY20_RS18805 (3916235) | 3916235..3916546 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NBY20_RS18810 (3916713) | 3916713..3917183 | - | 471 | WP_001551542.1 | hydrogenase maturation peptidase HycI | - |
| NBY20_RS18815 (3917176) | 3917176..3917586 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| NBY20_RS18820 (3917583) | 3917583..3918350 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NBY20_RS18825 (3918350) | 3918350..3918892 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| NBY20_RS18830 (3918902) | 3918902..3920611 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T247017 WP_000547555.1 NZ_CP098201:c3916546-3916235 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT247017 WP_000126294.1 NZ_CP098201:c3916238-3915819 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|