Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2355763..2356134 | Replicon | chromosome |
| Accession | NZ_CP098201 | ||
| Organism | Escherichia coli strain Z0117EC0056 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | NBY20_RS11385 | Protein ID | WP_001317028.1 |
| Coordinates | 2355940..2356134 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2355763..2355941 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY20_RS25285 (2351515) | 2351515..2351688 | + | 174 | WP_001296046.1 | protein YnaL | - |
| NBY20_RS11360 (2351718) | 2351718..2353091 | + | 1374 | WP_001551034.1 | ATP-dependent RNA helicase DbpA | - |
| NBY20_RS11365 (2353220) | 2353220..2354155 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| NBY20_RS11370 (2354207) | 2354207..2355442 | - | 1236 | WP_000040858.1 | site-specific integrase | - |
| NBY20_RS11375 (2355444) | 2355444..2355659 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2355763) | 2355763..2355941 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2355763) | 2355763..2355941 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2355763) | 2355763..2355941 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2355763) | 2355763..2355941 | + | 179 | NuclAT_0 | - | Antitoxin |
| NBY20_RS11380 (2355738) | 2355738..2355947 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| NBY20_RS11385 (2355940) | 2355940..2356134 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| NBY20_RS11390 (2356191) | 2356191..2357000 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| NBY20_RS11395 (2356993) | 2356993..2359593 | - | 2601 | WP_000105139.1 | exodeoxyribonuclease VIII | - |
| NBY20_RS11400 (2359695) | 2359695..2359970 | - | 276 | WP_000632297.1 | protein RacC | - |
| NBY20_RS11405 (2360045) | 2360045..2360215 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| NBY20_RS11410 (2360215) | 2360215..2360436 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2354207..2401013 | 46806 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T247008 WP_001317028.1 NZ_CP098201:c2356134-2355940 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT247008 NZ_CP098201:2355763-2355941 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
