Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1144545..1145239 | Replicon | chromosome |
| Accession | NZ_CP098201 | ||
| Organism | Escherichia coli strain Z0117EC0056 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NBY20_RS05560 | Protein ID | WP_001263491.1 |
| Coordinates | 1144841..1145239 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NBY20_RS05555 | Protein ID | WP_000554755.1 |
| Coordinates | 1144545..1144838 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY20_RS05530 (1140166) | 1140166..1140522 | - | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NBY20_RS05535 (1140515) | 1140515..1140793 | - | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NBY20_RS05540 (1140898) | 1140898..1142610 | - | 1713 | Protein_1065 | flagellar biosynthesis protein FlhA | - |
| NBY20_RS05545 (1142582) | 1142582..1143367 | + | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| NBY20_RS05550 (1143438) | 1143438..1144493 | + | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| NBY20_RS05555 (1144545) | 1144545..1144838 | + | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NBY20_RS05560 (1144841) | 1144841..1145239 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NBY20_RS05565 (1145249) | 1145249..1145701 | + | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| NBY20_RS05570 (1145947) | 1145947..1146153 | + | 207 | Protein_1071 | RtcB family protein | - |
| NBY20_RS05575 (1146149) | 1146149..1146501 | + | 353 | Protein_1072 | peptide chain release factor H | - |
| NBY20_RS05580 (1146558) | 1146558..1148015 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NBY20_RS05585 (1148276) | 1148276..1148734 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (1149330) | 1149330..1149410 | + | 81 | NuclAT_11 | - | - |
| - (1149330) | 1149330..1149410 | + | 81 | NuclAT_11 | - | - |
| - (1149330) | 1149330..1149410 | + | 81 | NuclAT_11 | - | - |
| - (1149330) | 1149330..1149410 | + | 81 | NuclAT_11 | - | - |
| NBY20_RS05590 (1148826) | 1148826..1150070 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T247003 WP_001263491.1 NZ_CP098201:1144841-1145239 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |