Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 1144545..1145239 Replicon chromosome
Accession NZ_CP098201
Organism Escherichia coli strain Z0117EC0056

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NBY20_RS05560 Protein ID WP_001263491.1
Coordinates 1144841..1145239 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NBY20_RS05555 Protein ID WP_000554755.1
Coordinates 1144545..1144838 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY20_RS05530 (1140166) 1140166..1140522 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
NBY20_RS05535 (1140515) 1140515..1140793 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NBY20_RS05540 (1140898) 1140898..1142610 - 1713 Protein_1065 flagellar biosynthesis protein FlhA -
NBY20_RS05545 (1142582) 1142582..1143367 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NBY20_RS05550 (1143438) 1143438..1144493 + 1056 WP_001550655.1 DNA polymerase IV -
NBY20_RS05555 (1144545) 1144545..1144838 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NBY20_RS05560 (1144841) 1144841..1145239 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NBY20_RS05565 (1145249) 1145249..1145701 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
NBY20_RS05570 (1145947) 1145947..1146153 + 207 Protein_1071 RtcB family protein -
NBY20_RS05575 (1146149) 1146149..1146501 + 353 Protein_1072 peptide chain release factor H -
NBY20_RS05580 (1146558) 1146558..1148015 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NBY20_RS05585 (1148276) 1148276..1148734 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (1149330) 1149330..1149410 + 81 NuclAT_11 - -
- (1149330) 1149330..1149410 + 81 NuclAT_11 - -
- (1149330) 1149330..1149410 + 81 NuclAT_11 - -
- (1149330) 1149330..1149410 + 81 NuclAT_11 - -
NBY20_RS05590 (1148826) 1148826..1150070 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T247003 WP_001263491.1 NZ_CP098201:1144841-1145239 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT247003 WP_000554755.1 NZ_CP098201:1144545-1144838 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References