Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 160431..161033 | Replicon | chromosome |
Accession | NZ_CP098201 | ||
Organism | Escherichia coli strain Z0117EC0056 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NBY20_RS00780 | Protein ID | WP_000897305.1 |
Coordinates | 160431..160742 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY20_RS00785 | Protein ID | WP_000356395.1 |
Coordinates | 160743..161033 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY20_RS00755 (155473) | 155473..155910 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NBY20_RS00760 (155955) | 155955..156896 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NBY20_RS00765 (157312) | 157312..158199 | + | 888 | Protein_137 | hypothetical protein | - |
NBY20_RS00770 (158212) | 158212..159126 | + | 915 | WP_109553727.1 | transposase | - |
NBY20_RS00775 (159294) | 159294..160202 | - | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
NBY20_RS00780 (160431) | 160431..160742 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NBY20_RS00785 (160743) | 160743..161033 | + | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
NBY20_RS00790 (161118) | 161118..161339 | + | 222 | WP_001550354.1 | hypothetical protein | - |
NBY20_RS00795 (161391) | 161391..161669 | + | 279 | WP_001315112.1 | hypothetical protein | - |
NBY20_RS00800 (162088) | 162088..162306 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NBY20_RS00805 (162525) | 162525..162767 | + | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
NBY20_RS00810 (162949) | 162949..163878 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NBY20_RS00815 (163875) | 163875..164510 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY20_RS00820 (164507) | 164507..165409 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T247000 WP_000897305.1 NZ_CP098201:160431-160742 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|