Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 63457..63721 | Replicon | plasmid pZ0117EC0062-3 |
Accession | NZ_CP098200 | ||
Organism | Escherichia coli strain Z0117EC0062 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | A0A8H9BDR8 |
Locus tag | NBY21_RS25305 | Protein ID | WP_023156060.1 |
Coordinates | 63569..63721 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 63457..63514 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY21_RS25290 (58570) | 58570..59781 | - | 1212 | WP_053285743.1 | DsbC family protein | - |
NBY21_RS25295 (59856) | 59856..61049 | - | 1194 | WP_250840887.1 | hypothetical protein | - |
NBY21_RS25300 (61065) | 61065..63278 | - | 2214 | WP_021560353.1 | type IA DNA topoisomerase | - |
- (63457) | 63457..63514 | - | 58 | NuclAT_0 | - | Antitoxin |
- (63457) | 63457..63514 | - | 58 | NuclAT_0 | - | Antitoxin |
- (63457) | 63457..63514 | - | 58 | NuclAT_0 | - | Antitoxin |
- (63457) | 63457..63514 | - | 58 | NuclAT_0 | - | Antitoxin |
NBY21_RS25305 (63569) | 63569..63721 | + | 153 | WP_023156060.1 | Hok/Gef family protein | Toxin |
NBY21_RS25310 (63793) | 63793..64044 | - | 252 | WP_001685192.1 | hypothetical protein | - |
NBY21_RS25515 (64359) | 64359..64454 | + | 96 | WP_000609149.1 | DinQ-like type I toxin DqlB | - |
NBY21_RS25320 (64560) | 64560..65513 | - | 954 | WP_141074322.1 | hypothetical protein | - |
NBY21_RS25325 (65582) | 65582..67726 | - | 2145 | WP_250840888.1 | DotA/TraY family protein | - |
NBY21_RS25330 (67761) | 67761..67985 | - | 225 | WP_021560350.1 | hypothetical protein | - |
NBY21_RS25335 (67988) | 67988..68551 | - | 564 | WP_021560349.1 | conjugal transfer protein TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..91127 | 91127 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5809.14 Da Isoelectric Point: 8.7948
>T246996 WP_023156060.1 NZ_CP098200:63569-63721 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246996 NZ_CP098200:c63514-63457 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|