Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35705..35969 | Replicon | plasmid pZ0117EC0062-1 |
| Accession | NZ_CP098198 | ||
| Organism | Escherichia coli strain Z0117EC0062 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | NBY21_RS24015 | Protein ID | WP_001331364.1 |
| Coordinates | 35705..35857 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 35912..35969 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY21_RS23985 (31171) | 31171..33339 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
| NBY21_RS23990 (33415) | 33415..34029 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NBY21_RS23995 (34127) | 34127..34336 | + | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| NBY21_RS24000 (34545) | 34545..34721 | + | 177 | WP_001054904.1 | hypothetical protein | - |
| NBY21_RS25505 (34786) | 34786..34881 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| NBY21_RS24010 (35382) | 35382..35633 | + | 252 | WP_001535703.1 | hypothetical protein | - |
| NBY21_RS24015 (35705) | 35705..35857 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (35912) | 35912..35969 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (35912) | 35912..35969 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (35912) | 35912..35969 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (35912) | 35912..35969 | + | 58 | NuclAT_0 | - | Antitoxin |
| NBY21_RS24020 (36149) | 36149..37357 | + | 1209 | WP_001535704.1 | IncI1-type conjugal transfer protein TrbA | - |
| NBY21_RS24025 (37376) | 37376..38446 | + | 1071 | WP_001535705.1 | IncI1-type conjugal transfer protein TrbB | - |
| NBY21_RS24030 (38439) | 38439..40730 | + | 2292 | WP_001289272.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) | - | 1..102319 | 102319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T246990 WP_001331364.1 NZ_CP098198:c35857-35705 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246990 NZ_CP098198:35912-35969 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
