Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4844137..4844739 | Replicon | chromosome |
Accession | NZ_CP098197 | ||
Organism | Escherichia coli strain Z0117EC0062 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NBY21_RS23080 | Protein ID | WP_000897305.1 |
Coordinates | 4844428..4844739 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY21_RS23075 | Protein ID | WP_000356395.1 |
Coordinates | 4844137..4844427 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY21_RS23040 (4839761) | 4839761..4840663 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NBY21_RS23045 (4840660) | 4840660..4841295 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY21_RS23050 (4841292) | 4841292..4842221 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NBY21_RS23055 (4842403) | 4842403..4842645 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
NBY21_RS23060 (4842864) | 4842864..4843082 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NBY21_RS23065 (4843501) | 4843501..4843779 | - | 279 | WP_001315112.1 | hypothetical protein | - |
NBY21_RS23070 (4843831) | 4843831..4844052 | - | 222 | WP_001550354.1 | hypothetical protein | - |
NBY21_RS23075 (4844137) | 4844137..4844427 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
NBY21_RS23080 (4844428) | 4844428..4844739 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NBY21_RS23085 (4844968) | 4844968..4845876 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
NBY21_RS23090 (4846044) | 4846044..4846958 | - | 915 | WP_109553727.1 | transposase | - |
NBY21_RS23095 (4846971) | 4846971..4847858 | - | 888 | Protein_4513 | hypothetical protein | - |
NBY21_RS23100 (4848274) | 4848274..4849215 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NBY21_RS23105 (4849260) | 4849260..4849697 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T246989 WP_000897305.1 NZ_CP098197:c4844739-4844428 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|